SPATA21 Antibody
| Name | SPATA21 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80730 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LKEGTCKAQEMEAAVGRLRLQKLPYNPQQEESSEVPERKVLSILSRLKQQNYAPNLQSPYAQVPCILLCPQLDKKMVRRQPSNHYAL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SPATA21 Protein |
| Description | Rabbit Polyclonal |
| Gene | SPATA21 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SPATA21 Antibody [NBP1-80730] - staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18664_SPATA21%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80730-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SPATA21 Antibody [NBP1-80730] - staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm & vesicles.
![Immunohistochemistry-Paraffin: SPATA21 Antibody [NBP1-80730] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes with distinct staining of intercalated discs.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18665_SPATA21%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80730-img0002.jpg)
Immunohistochemistry-Paraffin: SPATA21 Antibody [NBP1-80730] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes with distinct staining of intercalated discs.