Serine protease 23 Antibody
| Name | Serine protease 23 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80748 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Serine protease 23 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PRSS23 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Serine protease 23 Antibody [NBP1-80748] - Staining of human cell line U-251MG shows positivity in nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3589_Serine-protease-23-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80748-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Serine protease 23 Antibody [NBP1-80748] - Staining of human cell line U-251MG shows positivity in nucleoli.
![Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3590_Serine-protease-23-Antibody-Immunohistochemistry-Paraffin-NBP1-80748-img0005.jpg)
Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.