STMN4 Antibody
| Name | STMN4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80853 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | STMN4 Protein |
| Description | Rabbit Polyclonal |
| Gene | STMN4 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: STMN4 Antibody [NBP1-80853] - staining of human cell line U-251MG shows positivity in golgi apparatus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18711_STMN4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80853-img0003.jpg)
Immunocytochemistry/Immunofluorescence: STMN4 Antibody [NBP1-80853] - staining of human cell line U-251MG shows positivity in golgi apparatus & vesicles.
![Immunohistochemistry-Paraffin: STMN4 Antibody [NBP1-80853] - Staining of human small intestine shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18712_STMN4%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80853-img0002.jpg)
Immunohistochemistry-Paraffin: STMN4 Antibody [NBP1-80853] - Staining of human small intestine shows strong membranous positivity in glandular cells.