LRIF1 Antibody
| Name | LRIF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80834 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRIF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRIF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LRIF1 Antibody [NBP1-80834] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-323](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4432_LRIF1%2520Antibody-Western%2520Blot-NBP1-80834-img0004.jpg)
Western Blot: LRIF1 Antibody [NBP1-80834] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-323
![Immunohistochemistry-Paraffin: LRIF1 Antibody [NBP1-80834] - Staining of human testis shows strong cytoplasmic positivity in spermatids of seminiferus ducts of testis.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4433_LRIF1-Antibody-Immunohistochemistry-Paraffin-NBP1-80834-img0002.jpg)
Immunohistochemistry-Paraffin: LRIF1 Antibody [NBP1-80834] - Staining of human testis shows strong cytoplasmic positivity in spermatids of seminiferus ducts of testis.