PTD016 Antibody
| Name | PTD016 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80869 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHGSSSFSEFRYLFKWL |
| Description | Rabbit Polyclonal |
| Gene | RNFT1 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PTD016 Antibody [NBP1-80869] - staining of human cell line U-251MG shows positivity in nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18759_PTD016%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80869-img0004.jpg)
![Immunohistochemistry-Paraffin: PTD016 Antibody [NBP1-80869] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18760_PTD016%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80869-img0002.jpg)