C1orf210 Antibody
| Name | C1orf210 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81061 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C1orf210 Protein |
| Description | Rabbit Polyclonal |
| Gene | C1orf210 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: C1orf210 Antibody [NBP1-81061] - Staining of human kidney shows nucleolar positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2487_C1orf210%2520Antibody-Immunohistochemistry-Paraffin-NBP1-81061-img0002.jpg)
Immunohistochemistry-Paraffin: C1orf210 Antibody [NBP1-81061] - Staining of human kidney shows nucleolar positivity in renal tubules.