TRIM41 Antibody
| Name | TRIM41 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81228 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YKAKLQGHVEPLRKHLEAVQKMKAKEERRVTELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRIM41 Protein |
| Description | Rabbit Polyclonal |
| Gene | TRIM41 |
| Supplier Page | Shop |
Product images
![Western Blot: TRIM41 Antibody [NBP1-81228] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409431)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18907_TRIM41%2520Antibody-Western%2520Blot-NBP1-81228-img0004.jpg)
Western Blot: TRIM41 Antibody [NBP1-81228] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409431)
![Immunohistochemistry-Paraffin: TRIM41 Antibody [NBP1-81228] - Staining of human skeletal muscle shows strong positivity in subsets of muscle fibers.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18908_TRIM41-Antibody-Immunohistochemistry-Paraffin-NBP1-81228-img0002.jpg)
Immunohistochemistry-Paraffin: TRIM41 Antibody [NBP1-81228] - Staining of human skeletal muscle shows strong positivity in subsets of muscle fibers.