CCDC148 Antibody
| Name | CCDC148 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81217 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SRHDLVEHEKYCDQYRFAIEQQNILISNWNKNRKDFIQKAVLTLTEACATHEMESMLAKDKKKQQELCADLKAKVRQWRAHQEEVARLEME |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC148 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCDC148 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CCDC148 Antibody [NBP1-81217] - Staining of human cell line A-431 shows positivity in nucleoli & nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18919_CCDC148%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81217-img0003.jpg)
Immunocytochemistry/Immunofluorescence: CCDC148 Antibody [NBP1-81217] - Staining of human cell line A-431 shows positivity in nucleoli & nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: CCDC148 Antibody [NBP1-81217] - Staining of human vulva/anal skin shows strong cytoplasmic positivity in epidermal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18920_CCDC148%2520Antibody-Immunohistochemistry-Paraffin-NBP1-81217-img0002.jpg)
Immunohistochemistry-Paraffin: CCDC148 Antibody [NBP1-81217] - Staining of human vulva/anal skin shows strong cytoplasmic positivity in epidermal cells.