PDCD2L Antibody
| Name | PDCD2L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81211 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPG |
| Description | Rabbit Polyclonal |
| Gene | PDCD2L |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PDCD2L Antibody [NBP1-81211] - Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18939_PDCD2L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81211-img0004.jpg)
![Immunohistochemistry-Paraffin: PDCD2L Antibody [NBP1-81211] - Immunohistochemical staining of human small intestine shows cytoplasmic positivity in paneth cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/18940_PDCD2L%2520Antibody-Immunohistochemistry-Paraffin-NBP1-81211-img0001.jpg)