RPL34 Antibody

Name RPL34 Antibody
Supplier Novus Biologicals
Catalog NBP1-81331
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRG
Purity/Format Immunogen affinity purified
Blocking Peptide RPL34 Protein
Description Rabbit Polyclonal
Gene RPL34
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.