GPM6B Antibody

Name GPM6B Antibody
Supplier Novus Biologicals
Catalog NBP1-81271
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications FC IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Purity/Format Immunogen affinity purified
Blocking Peptide GPM6B Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene GPM6B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.