SLC38A6 Antibody
| Name | SLC38A6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81010 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC38A6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC38A6 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC38A6 Antibody [NBP1-81010] - Staining of human cell line A-431 shows positivity in nucleoli, plasma membrane, cytoskeleton (microtubules) & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19048_SLC38A6%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81010-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC38A6 Antibody [NBP1-81010] - Staining of human cell line A-431 shows positivity in nucleoli, plasma membrane, cytoskeleton (microtubules) & cell junctions.
![Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human kidney shows moderate positivity in cytoplasm and membranes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19049_SLC38A6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-81010-img0002.jpg)
Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human kidney shows moderate positivity in cytoplasm and membranes.