EPB41L4A Antibody

Name EPB41L4A Antibody
Supplier Novus Biologicals
Catalog NBP1-81009
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:SNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQPAESNSISRITANMENGENEGTIK
Purity/Format Immunogen affinity purified
Blocking Peptide EPB41L4A Protein
Description Rabbit Polyclonal
Gene EPB41L4A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.