RPP14 Antibody
| Name | RPP14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80965 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RPP14 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RPP14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RPP14 Antibody [NBP1-80965] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5099_RPP14%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80965-img0005.jpg)
Immunocytochemistry/Immunofluorescence: RPP14 Antibody [NBP1-80965] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: RPP14 Antibody [NBP1-80965] - Staining of human kidney shows strong cytoplasmic and membranous positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5100_RPP14-Antibody-Immunohistochemistry-Paraffin-NBP1-80965-img0002.jpg)
Immunohistochemistry-Paraffin: RPP14 Antibody [NBP1-80965] - Staining of human kidney shows strong cytoplasmic and membranous positivity in renal tubules.