KRTAP23-1 Antibody
| Name | KRTAP23-1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83069 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSYNCCCGNFSSHSCEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGNP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KRTAP23-1 Protein |
| Description | Rabbit Polyclonal |
| Gene | KRTAP23-1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: KRTAP23-1 Antibody [NBP1-83069] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3026_KRTAP23-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83069-img0004.jpg)
Immunocytochemistry/Immunofluorescence: KRTAP23-1 Antibody [NBP1-83069] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: KRTAP23-1 Antibody [NBP1-83069] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3027_KRTAP23-1-Antibody-Immunohistochemistry-Paraffin-NBP1-83069-img0005.jpg)
Immunohistochemistry-Paraffin: KRTAP23-1 Antibody [NBP1-83069] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.