SEC16A Antibody
| Name | SEC16A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83016 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SEC16A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SEC16A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SEC16A Antibody [NBP1-83016] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13329_SEC16A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83016-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SEC16A Antibody [NBP1-83016] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus.
![Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13330_SEC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-83016-img0004.jpg)
Immunohistochemistry-Paraffin: SEC16A Antibody [NBP1-83016] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes.