SPATA7 Antibody
| Name | SPATA7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83194 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRA |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SPATA7 |
| Supplier Page | Shop |
![Western Blot: SPATA7 Antibody [NBP1-83194] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19465_SPATA7%2520Antibody-Western%2520Blot-NBP1-83194-img0004.jpg)
![Immunohistochemistry-Paraffin: SPATA7 Antibody [NBP1-83194] - Staining of human testis shows moderate positivity in subsets of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19466_SPATA7-Antibody-Immunohistochemistry-Paraffin-NBP1-83194-img0003.jpg)