KIF15 Antibody

Name KIF15 Antibody
Supplier Novus Biologicals
Catalog NBP1-83252
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILD
Purity/Format Immunogen affinity purified
Blocking Peptide KIF15 Protein
Description Rabbit Polyclonal
Gene KIF15
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.