KIF13B Antibody
| Name | KIF13B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83398 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASYLNP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KIF13B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KIF13B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: KIF13B Antibody [NBP1-83398] - Analysis in human kidney tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25766_KIF13B-Antibody-Western-Blot-NBP1-83398-img0006.jpg)
![Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human parathyroid gland shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25767_KIF13B-Antibody-Immunohistochemistry-Paraffin-NBP1-83398-img0007.jpg)