LRRC57 Antibody
| Name | LRRC57 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83485 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRRC57 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRRC57 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/ Immunofluorescence: LRRC57 Antibody [NBP1-83485] - Staining of human cell line A-431 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5983_LRRC57-Antibody-Immunocytochemistry--Immunofluorescence-NBP1-83485-img0003.jpg)
Immunocytochemistry/ Immunofluorescence: LRRC57 Antibody [NBP1-83485] - Staining of human cell line A-431 shows positivity in mitochondria.
![Immunohistochemistry-Paraffin: LRRC57 Antibody [NBP1-83485] - Staining of human stomach, upper shows strong cytoplasmic and membrane positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5984_LRRC57-Antibody-Immunohistochemistry-Paraffin-NBP1-83485-img0004.jpg)
Immunohistochemistry-Paraffin: LRRC57 Antibody [NBP1-83485] - Staining of human stomach, upper shows strong cytoplasmic and membrane positivity in glandular cells.