TRIML1 Antibody
| Name | TRIML1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83489 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SAFVAQSHGANRVHLSSEAEEHHREKLQEILNLLRVRRKEAQAVLTHEKERVKLCQEETKTCKQVVVSEYMKMHQFLKEEE |
| Description | Rabbit Polyclonal |
| Gene | TRIML1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TRIML1 Antibody [NBP1-83489] - Staining of human cell line U-2 OS shows positivity in cytoplasm & cytoskeleton (microtubules).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19663_TRIML1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83489-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TRIML1 Antibody [NBP1-83489] - Staining of human cell line U-2 OS shows positivity in cytoplasm & cytoskeleton (microtubules).
![Immunohistochemistry-Paraffin: TRIML1 Antibody [NBP1-83489] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19664_TRIML1-Antibody-Immunohistochemistry-Paraffin-NBP1-83489-img0005.jpg)
Immunohistochemistry-Paraffin: TRIML1 Antibody [NBP1-83489] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.