HERC6 Antibody
| Name | HERC6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83639 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDLVDVQVKHIFAGTYANFVTTHQDTSSTRAPGKTLPEISRISQSM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HERC6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HERC6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HERC6 Antibody [NBP1-83639] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26567_HERC6%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83639-img0004.jpg)
Immunocytochemistry/Immunofluorescence: HERC6 Antibody [NBP1-83639] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
![Immunohistochemistry-Paraffin: HERC6 Antibody [NBP1-83639] - Staining of human tonsil shows distinct positivity in a subset of inflammatory cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26568_HERC6-Antibody-Immunohistochemistry-Paraffin-NBP1-83639-img0001.jpg)
Immunohistochemistry-Paraffin: HERC6 Antibody [NBP1-83639] - Staining of human tonsil shows distinct positivity in a subset of inflammatory cells.