FAM71A Antibody
| Name | FAM71A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83516 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SMSLSREGSVSLAIAGVVLTSRTAAEADMDAAAGPPVSTRQSKSSLSGQHGRERTQASAEGCKEGRERREKDRALGRSSHRRRTGESRHK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM71A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM71A |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM71A Antibody [NBP1-83516] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19817_FAM71A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83516-img0004.jpg)
Immunocytochemistry/Immunofluorescence: FAM71A Antibody [NBP1-83516] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm. Antibody staining is shown in green.
![Immunohistochemistry: FAM71A Antibody [NBP1-83516] - Staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19818_FAM71A-Antibody-Immunohistochemistry-NBP1-83516-img0003.jpg)
Immunohistochemistry: FAM71A Antibody [NBP1-83516] - Staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes.