FAM91A1 Antibody
| Name | FAM91A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83576 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDERGEPDLASGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM91A1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM91A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM91A1 Antibody [NBP1-83576] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4541_FAM91A1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83576-img0007.jpg)
Immunocytochemistry/Immunofluorescence: FAM91A1 Antibody [NBP1-83576] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules.
![Immunohistochemistry-Paraffin: FAM91A1 Antibody [NBP1-83576] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4542_FAM91A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83576-img0006.jpg)
Immunohistochemistry-Paraffin: FAM91A1 Antibody [NBP1-83576] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.