SLC7A6OS Antibody
| Name | SLC7A6OS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82260 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC7A6OS Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC7A6OS |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC7A6OS Antibody [NBP1-82260] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19895_SLC7A6OS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82260-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC7A6OS Antibody [NBP1-82260] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.
![Immunohistochemistry: SLC7A6OS Antibody [NBP1-82260] - Staining of human testis shows strong nuclear positivity in cells in seminiferus tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19896_SLC7A6OS-Antibody-Immunohistochemistry-NBP1-82260-img0003.jpg)
Immunohistochemistry: SLC7A6OS Antibody [NBP1-82260] - Staining of human testis shows strong nuclear positivity in cells in seminiferus tubules.