ZNF566 Antibody
| Name | ZNF566 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82222 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FQCSSFRDDWECNRQFKKELGSQGGHFNQLVFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEIIHTIEK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF566 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF566 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZNF566 Antibody [NBP1-82222] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4497_ZNF566%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82222-img0005.jpg)
Immunocytochemistry/Immunofluorescence: ZNF566 Antibody [NBP1-82222] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
![Immunohistochemistry-Paraffin: ZNF566 Antibody [NBP1-82222] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4498_ZNF566-Antibody-Immunohistochemistry-Paraffin-NBP1-82222-img0002.jpg)
Immunohistochemistry-Paraffin: ZNF566 Antibody [NBP1-82222] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.