SDCCAG10 Antibody
| Name | SDCCAG10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82509 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:EEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SDCCAG10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CWC27 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SDCCAG10 Antibody [NBP1-82509] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4649_SDCCAG10%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82509-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SDCCAG10 Antibody [NBP1-82509] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: SDCCAG10 Antibody [NBP1-82509] - Staining of human esophagus shows moderate nuclear and cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4650_SDCCAG10-Antibody-Immunohistochemistry-Paraffin-NBP1-82509-img0002.jpg)
Immunohistochemistry-Paraffin: SDCCAG10 Antibody [NBP1-82509] - Staining of human esophagus shows moderate nuclear and cytoplasmic positivity in squamous epithelial cells.