IFI44 Antibody
| Name | IFI44 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82614 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IFI44 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IFI44 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: IFI44 Antibody [NBP1-82614] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2525_IFI44-Antibody-Immunohistochemistry-NBP1-82614-img0008.jpg)
Immunohistochemistry: IFI44 Antibody [NBP1-82614] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.