GK5 Antibody
| Name | GK5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82692 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIFGVPIPIVAL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GK5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GK5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GK5 Antibody [NBP1-82692] - Staining of human cell line A-431 shows positivity in plasma membrane, vesicles and cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5711_GK5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82692-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GK5 Antibody [NBP1-82692] - Staining of human cell line A-431 shows positivity in plasma membrane, vesicles and cell junctions.
![Immunohistochemistry-Paraffin: GK5 Antibody [NBP1-82692] - Staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5712_GK5-Antibody-Immunohistochemistry-Paraffin-NBP1-82692-img0005.jpg)
Immunohistochemistry-Paraffin: GK5 Antibody [NBP1-82692] - Staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.