ZBED2 Antibody
| Name | ZBED2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82768 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GRLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERALEEVERAILEMKWKVRAEKEACQREKELPAAVHPFH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZBED2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZBED2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZBED2 Antibody [NBP1-82768] - Staining of human cell line U-251MG shows positivity in nucleus and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4667_ZBED2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82768-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ZBED2 Antibody [NBP1-82768] - Staining of human cell line U-251MG shows positivity in nucleus and cytoplasm.
![Immunohistochemistry-Paraffin: ZBED2 Antibody [NBP1-82768] - Staining of human salivary gland shows strong cytoplasmic and membranous positivity in ductal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4668_ZBED2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-82768-img0002.jpg)
Immunohistochemistry-Paraffin: ZBED2 Antibody [NBP1-82768] - Staining of human salivary gland shows strong cytoplasmic and membranous positivity in ductal cells.