MTA3 Antibody
| Name | MTA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82919 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MTA3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MTA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MTA3 Antibody [NBP1-82919] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25478_MTA3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82919-img0004.jpg)
Immunocytochemistry/Immunofluorescence: MTA3 Antibody [NBP1-82919] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles.
![Immunohistochemistry-Paraffin: MTA3 Antibody [NBP1-82919] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25479_MTA3-Antibody-Immunohistochemistry-Paraffin-NBP1-82919-img0002.jpg)
Immunohistochemistry-Paraffin: MTA3 Antibody [NBP1-82919] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
![Immunocytochemistry/Immunofluorescence: MTA3 Antibody [NBP1-82919] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25480_MTA3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82919-img0005.jpg)
Immunocytochemistry/Immunofluorescence: MTA3 Antibody [NBP1-82919] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.