ZNF462 Antibody
| Name | ZNF462 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85021 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:HGAALNTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHPKEIMENSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF462 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF462 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZNF462 Antibody [NBP1-85021] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20296_ZNF462%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85021-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ZNF462 Antibody [NBP1-85021] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: ZNF462 Antibody [NBP1-85021] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20297_ZNF462%2520Antibody-Immunohistochemistry-Paraffin-NBP1-85021-img0002.jpg)
Immunohistochemistry-Paraffin: ZNF462 Antibody [NBP1-85021] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.