METTL7A Antibody
| Name | METTL7A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85073 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | METTL7A Protein |
| Description | Rabbit Polyclonal |
| Gene | METTL7A |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: METTL7A Antibody [NBP1-85073] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20328_METTL7A-Antibody-Immunohistochemistry-Paraffin-NBP1-85073-img0002.jpg)
Immunohistochemistry-Paraffin: METTL7A Antibody [NBP1-85073] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
![Western Blot: METTL7A Antibody [NBP1-85073] - Lane 1: Mouse liver tissue lysate<br/>Lane 2: Rat liver tissue lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1486_METTL7A%2520Antibody-Western%2520Blot-NBP1-85073-img0005.jpg)
Western Blot: METTL7A Antibody [NBP1-85073] - Lane 1: Mouse liver tissue lysateLane 2: Rat liver tissue lysate
![Western Blot: METTL7A Antibody [NBP1-85073] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1487_METTL7A-Antibody-Western-Blot-NBP1-85073-img0004.jpg)
Western Blot: METTL7A Antibody [NBP1-85073] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue