SLC37A3 Antibody
| Name | SLC37A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85028 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TFSNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFPSAEKATL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC37A3 Protein |
| Description | Rabbit Polyclonal |
| Gene | SLC37A3 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC37A3 Antibody [NBP1-85028] - Immunofluorescent staining of human cell line U-251MG shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20355_SLC37A3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85028-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SLC37A3 Antibody [NBP1-85028] - Immunofluorescent staining of human cell line U-251MG shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: SLC37A3 Antibody [NBP1-85028] - Staining of human esophagus shows strong membranous and cytoplasmic positivity in squamous epithelial cells(above basal layer).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20356_SLC37A3%2520Antibody-Immunohistochemistry-Paraffin-NBP1-85028-img0002.jpg)
Immunohistochemistry-Paraffin: SLC37A3 Antibody [NBP1-85028] - Staining of human esophagus shows strong membranous and cytoplasmic positivity in squamous epithelial cells(above basal layer).