ZDHHC18 Antibody
| Name | ZDHHC18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85057 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZDHHC18 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZDHHC18 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZDHHC18 Antibody [NBP1-85057] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (microtubules).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20365_ZDHHC18%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85057-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ZDHHC18 Antibody [NBP1-85057] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (microtubules).
![Immunohistochemistry-Paraffin: ZDHHC18 Antibody [NBP1-85057] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20366_ZDHHC18%2520Antibody-Immunohistochemistry-Paraffin-NBP1-85057-img0002.jpg)
Immunohistochemistry-Paraffin: ZDHHC18 Antibody [NBP1-85057] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.