KIF18A Antibody
| Name | KIF18A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85127 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTFTICEDIKSSKCKLPEQESLPNDNKDILQRLDP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KIF18A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KIF18A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: KIF18A Antibody [NBP1-85127] - Analysis in human cell line RH-30.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25769_KIF18A%2520Antibody-Western%2520Blot-NBP1-85127-img0005.jpg)
![Immunohistochemistry-Paraffin: KIF18A Antibody [NBP1-85127] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25770_KIF18A-Antibody-Immunohistochemistry-Paraffin-NBP1-85127-img0002.jpg)