HBS1L Antibody
| Name | HBS1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85124 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HBS1L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HBS1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HBS1L Antibody [NBP1-85124] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5944_HBS1L-Antibody-Western-Blot-NBP1-85124-img0003.jpg)
Western Blot: HBS1L Antibody [NBP1-85124] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA
![Immunocytochemistry/Immunofluorescence: HBS1L Antibody [NBP1-85124] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5945_HBS1L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85124-img0005.jpg)
Immunocytochemistry/Immunofluorescence: HBS1L Antibody [NBP1-85124] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
![Immunohistochemistry-Paraffin: HBS1L Antibody [NBP1-85124] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5946_HBS1L-Antibody-Immunohistochemistry-Paraffin-NBP1-85124-img0004.jpg)
Immunohistochemistry-Paraffin: HBS1L Antibody [NBP1-85124] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.