MAS1L Antibody
| Name | MAS1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85157 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MAS1L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MAS1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MAS1L Antibody [NBP1-85157] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9249_MAS1L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85157-img0004.jpg)
Immunocytochemistry/Immunofluorescence: MAS1L Antibody [NBP1-85157] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: MAS1L Antibody [NBP1-85157] - Staining of human testis shows strong positivity in basal cells of ductus seminiferus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9250_MAS1L-Antibody-Immunohistochemistry-Paraffin-NBP1-85157-img0001.jpg)
Immunohistochemistry-Paraffin: MAS1L Antibody [NBP1-85157] - Staining of human testis shows strong positivity in basal cells of ductus seminiferus.