HAPLN1 Antibody

Name HAPLN1 Antibody
Supplier Novus Biologicals
Catalog NBP1-85443
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIH
Purity/Format Immunogen affinity purified
Blocking Peptide HAPLN1 Protein
Description Rabbit Polyclonal
Gene HAPLN1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.