Connexin 30/GJB6 Antibody
| Name | Connexin 30/GJB6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85377 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Connexin 30/GJB6 Protein |
| Description | Rabbit Polyclonal |
| Gene | GJB6 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GJB6 Antibody [NBP1-85377] Staining of human cell line U-2 OS shows positivity in plasma membrane & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20575_GJB6%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85377-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GJB6 Antibody [NBP1-85377] Staining of human cell line U-2 OS shows positivity in plasma membrane & vesicles.
![Immunohistochemistry-Paraffin: GJB6 Antibody [NBP1-85377] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20576_GJB6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-85377-img0001.jpg)
Immunohistochemistry-Paraffin: GJB6 Antibody [NBP1-85377] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity.