CPNE4 Antibody
| Name | CPNE4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85513 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCIN |
| Description | Rabbit Polyclonal |
| Gene | CPNE4 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CPNE4 Antibody [NBP1-85513] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20603_CPNE4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85513-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CPNE4 Antibody [NBP1-85513] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: CPNE4 Antibody [NBP1-85513] - Immunohistochemical staining of human kidney shows strong luminal membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20604_CPNE4%2520Antibody-Immunohistochemistry-Paraffin-NBP1-85513-img0001.jpg)
Immunohistochemistry-Paraffin: CPNE4 Antibody [NBP1-85513] - Immunohistochemical staining of human kidney shows strong luminal membranous positivity in cells in tubules.