MARCH8 Antibody

Name MARCH8 Antibody
Supplier Novus Biologicals
Catalog NBP1-85540
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:VQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGAEIIHV
Purity/Format Immunogen affinity purified
Blocking Peptide MARCH8 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene MARCH8
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.