CCRL2/CRAM-A/B Antibody
| Name | CCRL2/CRAM-A/B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85588 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCRL2/CRAM-A/B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCRL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CCRL2 Antibody [NBP1-85588] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13316_CCRL2%2520Antibody-Western%2520Blot-NBP1-85588-img0004.jpg)
Western Blot: CCRL2 Antibody [NBP1-85588] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
![Immunohistochemistry-Paraffin: CCRL2/CRAM-A/B Antibody [NBP1-85588] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and cells in white pulp.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13317_CCRL2-CRAM-A-B-Antibody-Immunohistochemistry-Paraffin-NBP1-85588-img0005.jpg)
Immunohistochemistry-Paraffin: CCRL2/CRAM-A/B Antibody [NBP1-85588] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and cells in white pulp.
![Immunohistochemistry-Paraffin: CCRL2 Antibody [NBP1-85588] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13318_CCRL2-Antibody-Immunohistochemistry-Paraffin-NBP1-85588-img0001.jpg)
Immunohistochemistry-Paraffin: CCRL2 Antibody [NBP1-85588] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.