FCER1G Antibody
| Name | FCER1G Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85959 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FCER1G Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FCER1G |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2758_FCER1G-Antibody-Immunohistochemistry-Paraffin-NBP1-85959-img0001.jpg)
Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.