ALS2CR12 Antibody
| Name | ALS2CR12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85902 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ALS2CR12 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ALS2CR12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ALS2CR12 Antibody [NBP1-85902] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26463_ALS2CR12%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85902-img0005.jpg)
Immunocytochemistry/Immunofluorescence: ALS2CR12 Antibody [NBP1-85902] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: ALS2CR12 Antibody [NBP1-85902] - Staining of human vulva/anal skin shows strong cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26464_ALS2CR12-Antibody-Immunohistochemistry-Paraffin-NBP1-85902-img0004.jpg)
Immunohistochemistry-Paraffin: ALS2CR12 Antibody [NBP1-85902] - Staining of human vulva/anal skin shows strong cytoplasmic positivity in squamous epithelial cells.
![Immunocytochemistry/Immunofluorescence: ALS2CR12 Antibody [NBP1-85902] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26465_ALS2CR12-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85902-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ALS2CR12 Antibody [NBP1-85902] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.