RBM12B Antibody
| Name | RBM12B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85981 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RBM12B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RBM12B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RBM12B Antibody [NBP1-85981] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-462](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5508_RBM12B%2520Antibody-Western%2520Blot-NBP1-85981-img0004.jpg)
![Immunohistochemistry-Paraffin: RBM12B Antibody [NBP1-85981] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5509_RBM12B-Antibody-Immunohistochemistry-Paraffin-NBP1-85981-img0002.jpg)