GCSH Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-85842
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: GCSH Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: GCSH
• Conjugate: Unconjugated

Product images

Western Blot: GCSH Antibody [NBP1-85842] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate

Immunohistochemistry-Paraffin: GCSH Antibody [NBP1-85842] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules..

Western Blot: GCSH Antibody [NBP1-85842] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue