ME3 Antibody
| Name | ME3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85871 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ME3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PCDHGA5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ME3 Antibody [NBP1-85871] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13571_ME3-Antibody-Western-Blot-NBP1-85871-img0007.jpg)
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human parathyroid gland shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13572_ME3-Antibody-Immunohistochemistry-Paraffin-NBP1-85871-img0008.jpg)
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human parathyroid gland shows moderate cytoplasmic positivity in glandular cells.
![Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13573_ME3-Antibody-Western-Blot-NBP1-85871-img0006.jpg)
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.