S100A13 Antibody
| Name | S100A13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86039 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | S100A13 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | S100A13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: S100A13 Antibody [NBP1-86039] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29755_S100A13-Antibody-Western-Blot-NBP1-86039-img0008.jpg)
Western Blot: S100A13 Antibody [NBP1-86039] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunohistochemistry-Paraffin: S100A13 Antibody [NBP1-86039] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29756_S100A13-Antibody-Immunohistochemistry-Paraffin-NBP1-86039-img0009.jpg)
Immunohistochemistry-Paraffin: S100A13 Antibody [NBP1-86039] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.
![Western Blot: S100A13 Antibody [NBP1-86039] - Analysis in human cell line MCF-7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29757_S100A13-Antibody-Western-Blot-NBP1-86039-img0006.jpg)
Western Blot: S100A13 Antibody [NBP1-86039] - Analysis in human cell line MCF-7.