PKIG Antibody
| Name | PKIG Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86212 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PKIG Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PKIG |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PKIG Antibody [NBP1-86212] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/21105_PKIG%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86212-img0003.jpg)
Immunocytochemistry/Immunofluorescence: PKIG Antibody [NBP1-86212] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.
![Immunohistochemistry-Paraffin: PKIG Antibody [NBP1-86212] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/21106_PKIG%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86212-img0002.jpg)
Immunohistochemistry-Paraffin: PKIG Antibody [NBP1-86212] - Staining of human rectum shows strong nuclear positivity in glandular cells.